01
From Castles to Karens: The Accidental Rise of Grass
Apr 16, 2026
From Castles to Karens: The Accidental Rise of Grass

A brief and extremely dumb history of lawns — and how a status symbol survived long enough to become enforced.

satirepermacultureecologyculturelawn
Read it
Golf Is a Stupid Sport Played on Perfectly Good Land
Apr 16, 2026
Golf Is a Stupid Sport Played on Perfectly Good Land

Three million acres of pesticide-soaked monoculture so wealthy men can LARP as athletes. Here's how permaculture could fix it.

satirepermacultureecologyculturelawn
Read it
Duckweed: Nature Submitted a Patch. We Rejected It.
Apr 15, 2026
Duckweed: Nature Submitted a Patch. We Rejected It.

Water purification, protein production, and why we keep fighting free solutions.

satirepermacultureregenerationwaterecology
Read it
Garbage Patch: The Hottest Real Estate Nobody's Talking About
Apr 13, 2026
Garbage Patch: The Hottest Real Estate Nobody's Talking About

While coastal cities sink, one island grows. It's self-building, sea-level resistant, fully furnished, and priced to move. Introducing the Great Pacific Garbage Patch — civilization's finest unintentional achievement.

satireoceansmicroplasticsgreenwashingecosystems
Read it
We Saved the Lake by Killing It!
Aug 13, 2025
We Saved the Lake by Killing It!

Lake Huron looks crystal clear because the web is collapsing underneath. Clarity isn't redemption—it's a death mask.

satireecosystemslakesinvasivesgreenwashing
Read it
Genghis Khan: History's Greatest Environmentalist
Aug 10, 2025
Genghis Khan: History's Greatest Environmentalist

How one man slashed global CO₂ using nothing but horses, composite bows, and a remarkably effective approach to eliminating emissions at the source.

satirehistoryrewildingcarbon
Read it
Lawn Apocalypse
Jan 10, 2025
Lawn Apocalypse

Lawns are thirsty, loud, and biologically bankrupt. Mulch the monoculture and seed the chaos.

satirepermaculture
Read it
02
Fertilizer vs Soil: Why One Feeds Plants and the Other Keeps Them Fed
Apr 16, 2026
Fertilizer vs Soil: Why One Feeds Plants and the Other Keeps Them Fed

Most plant problems don't start with a lack of nutrients — they start with how those nutrients are delivered.

guidepermaculturesoilfertilitycomposting
Read it
How to Produce Your Own Fertility
Apr 16, 2026
How to Produce Your Own Fertility

Stop buying what your system can generate. Most fertility already exists on-site — the difference is whether you keep it or throw it away.

guidepermaculturesoilfertilitycomposting
Read it
Duckweed (Lemnaceae): From Nuisance Species to Functional Infrastructure
Apr 15, 2026
Duckweed (Lemnaceae): From Nuisance Species to Functional Infrastructure

Re-evaluating a Misclassified Aquatic Resource.

guidepermacultureregenerationwaterecology
Read it
Plant Families & Permaculture
Apr 11, 2026
Plant Families & Permaculture

Why plant families matter for companion planting, crop rotation, pest cycles, guild design, seed saving, and resilient food systems.

guidebotanypermacultureplant familiesguilds
Read it
Vermicomposting Guide
Aug 19, 2025
Vermicomposting Guide

Turn kitchen scraps into living, microbe-rich compost with red wigglers (Eisenia fetida). Setup, feeding, harvesting, and fixes.

guidevermicompostingsoilcompost
Read it
The Hidden World Beneath Our Feet
Aug 15, 2025
The Hidden World Beneath Our Feet

Soil isn’t dirt—it’s a living engine. How microbes, structure, and regenerative practices drive fertility, carbon storage, and resilience.

guidesoilmicrobiologypermacultureregeneration
Read it
Moringa: The Miracle Tree for Health and Sustainability
Aug 12, 2025
Moringa: The Miracle Tree for Health and Sustainability

What Moringa oleifera is, why it’s praised nutritionally, traditional uses, and practical ways to include it—plus a few cautions.

guidemoringaherbsnutritionplants
Read it
How to Make a Worm Bin
Aug 11, 2025
How to Make a Worm Bin

DIY worm bin setup: drill the tote, add bedding, feed red wigglers, harvest castings. Simple, cheap, indoor-friendly.

guidevermicompostingworm binhow-to
Read it
Turmeric: The Golden Spice with Powerful Health Benefits
Aug 11, 2025
Turmeric: The Golden Spice with Powerful Health Benefits

What turmeric is, why people use it, and practical ways to add it to food and daily routines—plus tips to improve absorption.

guideturmericherbswellbeing
Read it
Unlocking Nature’s Blueprint: Bill Mollison’s Revolutionary Permaculture Secrets
Aug 8, 2025
Unlocking Nature’s Blueprint: Bill Mollison’s Revolutionary Permaculture Secrets

Mollison’s ethics, water-and-soil design, ecological indicators, and quietly radical tactics for creating regenerative systems.

permaculturedesignmollisonwatersoilecology
Read it